Castellaniella defragrans: BN940_07901 Help Entry BN940_07901       CDS       T03058                                  Name (GenBank) Sarcosine oxidase delta subunit   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism cdn  Castellaniella defragrans Pathway cdn00260   Glycine, serine and threonine metabolism cdn01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:cdn00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     BN940_07901 Enzymes [BR:cdn01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      BN940_07901     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      BN940_07901 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Lar_restr_allev F-box_5 Motif Other DBs NCBI-ProteinID:  CDM24043 UniProt:  W8WWC8 LinkDB All DBs Position 1683931..1684230 Genome browser AA seq 99 aa AA seqDB search MLQIKCPWCGERAESEFSYGGEAGIVRPVDNASMDDREWGDYVFMRRNTFGLFREQWVHT HGCRRWFIAERDTRTYDIRGYETFADQSHETAEPIREAV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctgcagatcaaatgcccctggtgcggggaacgcgccgaaagcgaattcagttatggg ggggaggccggcattgtgcgccccgtggacaacgcttcgatggatgatcgtgaatggggc gattacgtattcatgcgccgcaacactttcgggctgtttcgcgagcagtgggtccacacc cacggttgccgccgctggttcatagccgagcgcgatacgcggacctatgacatccggggc tacgagaccttcgctgatcagagtcacgaaaccgcagaaccgatccgggaggccgtatga

DBGET integrated database retrieval system