KEGG   Corynebacterium diphtheriae HC03: CDHC03_2169
Entry
CDHC03_2169       CDS       T01695                                 
Symbol
ssb1
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
cdr  Corynebacterium diphtheriae HC03
Pathway
cdr03030  DNA replication
cdr03430  Mismatch repair
cdr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CDHC03_2169 (ssb1)
   03430 Mismatch repair
    CDHC03_2169 (ssb1)
   03440 Homologous recombination
    CDHC03_2169 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdr03032]
    CDHC03_2169 (ssb1)
   03400 DNA repair and recombination proteins [BR:cdr03400]
    CDHC03_2169 (ssb1)
   03029 Mitochondrial biogenesis [BR:cdr03029]
    CDHC03_2169 (ssb1)
DNA replication proteins [BR:cdr03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CDHC03_2169 (ssb1)
DNA repair and recombination proteins [BR:cdr03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CDHC03_2169 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CDHC03_2169 (ssb1)
Mitochondrial biogenesis [BR:cdr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CDHC03_2169 (ssb1)
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 SSB_1 Ribosomal_S3_C
Other DBs
NCBI-ProteinID: AEX79894
LinkDB
Position
complement(2370006..2370587)
AA seq 193 aa
MAQGDVNITVVGNLVADPELRFTPSGAAVANFRIASTPRRYDSQTNQWVDGEALFLQCNI
WRQAAENVAESLTKGMRVIVTGRLRQRSYETREGEKRSVMELEVDEVGPSLRYAAASVNR
NPREGGNGGGNFGGSQGGFGGNTGGNSGGGFGAPQGGFGGGPQNSQSAAPANDPWSSAPQ
AGGFGGAEQDPPF
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcacaaggagatgtcaacataaccgttgtcggcaacctcgttgctgatccggagctt
cgcttcacccctagcggtgcagcggtggcaaacttccgcattgcctccaccccacgtcgt
tacgactctcaaacgaaccagtgggtagacggcgaagccttgttcctgcagtgcaacatt
tggcgccaagctgccgaaaacgtcgcagaatccctgaccaagggcatgcgcgtgatcgtc
actggccgtttgcgtcaacgctcctacgaaacccgtgagggcgaaaagcgcagcgtcatg
gagcttgaggtcgacgaagtcggcccatccctacgctacgcagcagcaagcgtgaaccgt
aaccctcgcgagggtggaaacggcggaggaaacttcggcggctcccagggtggtttcggc
ggaaacaccggaggcaactcaggtggcggattcggcgctcctcaaggtggcttcggaggc
ggcccgcagaactcccagagtgctgcaccagccaacgatccatggagcagtgccccgcaa
gcaggtggattcggcggtgcggagcaagatccaccgttctaa

DBGET integrated database retrieval system