Corynebacterium diphtheriae HC01: CDHC01_1628 Help Entry CDHC01_1628       CDS       T01693                                  Symbol acpM Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cdt  Corynebacterium diphtheriae HC01 Pathway cdt01100   Metabolic pathways cdt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cdt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CDHC01_1628 (acpM)    00074 Mycolic acid biosynthesis     CDHC01_1628 (acpM)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CDHC01_1628 (acpM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  AEX74872 LinkDB All DBs Position 1716902..1717159 Genome browser AA seq 85 aa AA seqDB search MQSDQPSSNSQEEATTFSRVCAVLKRVGLDPEEMTPDTVLEDAGVDSLDRIEITVRLEQE SGIELHAADVFPARTVHDLMQLIDQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ttgcaatccgatcagccctcttcaaattctcaagaggaagcaaccactttttcacgggtg tgtgcggtgctcaaacgcgtaggtcttgatcccgaggagatgactcccgataccgtttta gaagatgctggagtcgattctttggatcgtattgagatcacagttcgccttgaacaagaa agcggcatcgagcttcacgccgccgacgtgtttccggctcgtacggtgcatgacttgatg caattgattgatcaataa

DBGET integrated database retrieval system