KEGG   Candida dubliniensis: CD36_51220
Entry
CD36_51220        CDS       T01140                                 
Symbol
CLN2
Name
(RefSeq) G1/S-specific cyclin, putative
  KO
K06646  G1/S-specific cyclin CLN3
Organism
cdu  Candida dubliniensis
Pathway
cdu04111  Cell cycle - yeast
cdu04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cdu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    CD36_51220 (CLN2)
   04113 Meiosis - yeast
    CD36_51220 (CLN2)
SSDB
Motif
Pfam: Cyclin_N SUIM_assoc
Other DBs
NCBI-GeneID: 8048119
NCBI-ProteinID: XP_002420426
UniProt: B9WH63
LinkDB
Position
5:313604..315043
AA seq 479 aa
MFPNSPDAFHQVRMMQSSIKASNFKLQSMEFKCHSYNVCEYQMEMLHHLLTVEAKTLPSL
SLIEQQPEIKLGMRPLLLDFLMEVITILNLSRSTFPLTVNLIDRYCSTRIVKKQHYQLLG
LTSLWISCKNLDSKFKVPTLNDLRKICVDSYYKELFVEMEKHILKSLEWVVNAPTFDAFI
DLYSNLLISNSSNVEVANIVKKSSHKIKLFSNYIGELFQFYPNIYYDYTSSQIALIAILI
TVLTLKIPVDLISLLNFYNGLVKTDMFKSNIEQGSDNEFEEILSVESFKSLFNKSFFKNL
IKIIDNPPSSLKIKYFADNGKYSVLMKQLVTTATNTLKCMLDPVPTTPKANSFVKQQHHH
HHNQQQQQQQQQQQQHYCPRPPMSINTSMIPLTPVSNSTSPNRFSPDQIFSENESTPGIA
FGTMTPDSQSTSPGEKRSYECIDELEIGTSTITSYTSKNHDTLKRSKSANYGTLFYLQQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgtttcctaattcacctgatgctttccatcaagttaggatgatgcaatccctgatcaaa
gcaagtaatttcaagttgcaatcaatggaattcaaatgtcattcatataatgtatgtgaa
taccaaatggaaatgttacatcacttgttaacagttgaagctaaaacattgcctagtcta
tcattaattgaacaacaaccagaaattaaattaggtatgagaccattattgttggacttt
ttaatggaagttatcaccattcttaacttgtccagatctacattcccattgactgtcaat
ttgattgatcgttattgttcaacaagaattgttaagaagcaacattatcagttgttggga
ttaactagtctttggattagttgtaagaatttggattcaaaatttaaggttcctacatta
aatgatttacgaaaaatctgtgtcgatagttattacaaagaattgtttgttgaaatggaa
aaacacatattaaaatcattagaatgggtcgtcaatgctcctacatttgatgcctttatt
gatttatattcaaatttgttgatttctaatagtagtaacgttgaggttgcaaacattgtc
aagaagtcatctcataaaataaaattgttttccaattatattggtgaattgttccagttt
tatccaaacatttattacgattatacatcgtcacagattgctttgattgctattttgatt
acagttttgacattgaaaattcctgttgatttaattagtttgttgaacttttataatgga
ttggttaagaccgatatgtttaagtccaatattgaacaaggttccgataatgagtttgaa
gaaattctttcagttgagtctttcaaatcattatttaacaagagttttttcaagaacttg
attaagataattgataatcctccaagcagtctcaagattaagtattttgctgacaatggt
aaatattcggtattgatgaagcaattggttactactgctaccaatactttgaaatgtatg
ttggatcctgttccaacaacaccaaaggctaacagttttgtcaaacagcaacatcatcat
catcataatcaacaacaacaacaacaacaacaacaacaacaacaacactattgtccaaga
ccaccaatgagtatcaatacctcaatgattccattgacaccggtgtctaatagtactagc
cctaatagattcagtcccgatcagatattttcggaaaatgaatctacacctggtattgca
tttggtaccatgacgcctgattcccaatcaacatcacctggggaaaaacgaagttatgaa
tgcattgatgagttagagattggcacatcaacaattactagttatacactgaaaaatcat
gatacattgaaaagatcgaaaagtgctaattatggtacacttttctatcttcaacaataa

DBGET integrated database retrieval system