Corynebacterium diphtheriae PW8: CDPW8_0657 Help Entry CDPW8_0657        CDS       T01701                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism cdw  Corynebacterium diphtheriae PW8 Pathway cdw00074   Mycolic acid biosynthesis cdw00280   Valine, leucine and isoleucine degradation cdw00630   Glyoxylate and dicarboxylate metabolism cdw00640   Propanoate metabolism cdw01100   Metabolic pathways cdw01110   Biosynthesis of secondary metabolites cdw01120   Microbial metabolism in diverse environments cdw01200   Carbon metabolism Module cdw_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA cdw_M00887   Mycolic acid biosynthesis, meromycolic acid + alpha-carboxyacyl-CoA + trehalose => TMM => TDM/mAGP/GMM Brite KEGG Orthology (KO) [BR:cdw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     CDPW8_0657    00640 Propanoate metabolism     CDPW8_0657   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     CDPW8_0657   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     CDPW8_0657 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon T2SSK HHV-5_US34A Motif Other DBs NCBI-ProteinID:  AEX69313 LinkDB All DBs Position complement(660661..660921) Genome browser AA seq 86 aa AA seqDB search MSDSVSDTQAQSTPESAQQKPILRVVKGNPDPTQVATLTALFASMADNAAQQSKQERERN LWGSIEERLQRPRTYNPTAFRNMSFF NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtctgactcagtatctgacacacaagctcagtcaacgccagagagcgcacagcaaaag ccgattctgcgtgttgttaaaggcaaccccgatccaacacaagtagctaccctgacggcc ctttttgcatccatggcagacaatgctgcacagcaatccaagcaagagcgcgaacgcaac ttgtggggaagcatagaagagcgccttcagcgccccagaacctacaaccccaccgcgttt agaaacatgagcttcttctaa

DBGET integrated database retrieval system