KEGG   Corynebacterium diphtheriae 31A: CD31A_1151
Entry
CD31A_1151        CDS       T01697                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz00770  Pantothenate and CoA biosynthesis
cdz01100  Metabolic pathways
cdz01240  Biosynthesis of cofactors
Module
cdz_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cdz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CD31A_1151 (coaD)
Enzymes [BR:cdz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     CD31A_1151 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig FAD_syn
Other DBs
NCBI-ProteinID: AEX41826
LinkDB
Position
1152181..1152660
AA seq 159 aa
MRKAVCPGSFDPVTMGHLDIIGRAAQQYDEVTVLVTANPNKPSGMFTVDERLALIKESTA
HFVNVKVDNWAGLLVDYTTANGIDAIVKGLRTALDYEYELPMAQMNRKLAGVDTLFLMTD
PQYGYISSTLCKEVTKYGGDVSDMLPPAVAAAIVEKVKS
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcgtaaagcagtgtgcccaggatcttttgacccagtgactatggggcatcttgacatc
atcggaagggcggcccagcaatacgacgaggtcaccgttttagtgactgctaaccccaat
aagccctcaggtatgttcaccgtcgatgaacgccttgcccttattaaagaatccactgcg
cattttgtgaatgtcaaagtggataactgggcagggctccttgttgattacactacggcc
aacgggatcgatgcaatcgtcaaagggcttcgaacggcactggattacgaatatgagcta
cccatggctcagatgaaccgaaagctagctggtgtggacaccctgtttttgatgacagat
ccacaatatggttacatttcttctaccctctgtaaggaagtaactaaatatggtggggac
gtctcagatatgttgccgccagctgtagccgcagcgattgtggagaaagtaaaaagctaa

DBGET integrated database retrieval system