KEGG   Corynebacterium diphtheriae 31A: CD31A_2313
Entry
CD31A_2313        CDS       T01697                                 
Symbol
ssb1
Name
(GenBank) single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
cdz  Corynebacterium diphtheriae 31A
Pathway
cdz03030  DNA replication
cdz03430  Mismatch repair
cdz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cdz00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CD31A_2313 (ssb1)
   03430 Mismatch repair
    CD31A_2313 (ssb1)
   03440 Homologous recombination
    CD31A_2313 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cdz03032]
    CD31A_2313 (ssb1)
   03400 DNA repair and recombination proteins [BR:cdz03400]
    CD31A_2313 (ssb1)
   03029 Mitochondrial biogenesis [BR:cdz03029]
    CD31A_2313 (ssb1)
DNA replication proteins [BR:cdz03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CD31A_2313 (ssb1)
DNA repair and recombination proteins [BR:cdz03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     CD31A_2313 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    CD31A_2313 (ssb1)
Mitochondrial biogenesis [BR:cdz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    CD31A_2313 (ssb1)
SSDB
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2 SSB_1 Ribosomal_S3_C
Other DBs
NCBI-ProteinID: AEX42978
LinkDB
Position
complement(2435146..2435727)
AA seq 193 aa
MAQGDVNITVVGNLVADPELRFTPSGAAVANFRIASTPRRYDSQTNQWVDGEALFLQCNI
WRQAAENVAESLTKGMRVIVTGRLRQRSYETREGEKRSVMELEVDEVGPSLRYAAASVNR
NPREGGNGGGNFGGSQGGFGGNTGGNSGGGFGAPQGGFGGGPQNSQSAAPANDPWSSAPQ
AGGFGGAEQDPPF
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcacaaggagatgtcaacataaccgttgtcggcaacctcgttgctgatccggagctt
cgcttcacccctagcggtgcagcggtggcaaacttccgcattgcctccaccccacgtcgt
tacgactctcaaacgaaccagtgggtagacggcgaagccttgttcctgcagtgcaacatt
tggcgccaagctgccgaaaacgtcgcagaatccctgaccaagggcatgcgcgtgatcgtc
actggccgtttgcgtcaacgctcctacgaaacccgtgagggcgaaaagcgcagcgtcatg
gagcttgaggtcgacgaagtcggcccatccctacgctacgcagcagcaagcgtgaaccgt
aaccctcgcgagggtggaaacggcggaggaaacttcggcggctcccagggtggtttcggc
ggaaacaccggaggcaactcaggtggcggattcggcgctcctcaaggtggcttcggaggc
ggcccgcagaactcccagagtgctgcaccagccaacgatccatggagcagtgccccgcaa
gcaggtggattcggcggtgcggagcaagatccaccgttctaa

DBGET integrated database retrieval system