Cellvibrio sp. PSBB023: B0D95_03900 Help Entry B0D95_03900       CDS       T04725                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ceb  Cellvibrio sp. PSBB023 Pathway ceb01100   Metabolic pathways ceb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ceb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0D95_03900    00074 Mycolic acid biosynthesis     B0D95_03900   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0D95_03900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Gag_p24_C Motif Other DBs NCBI-ProteinID:  AQT59329 UniProt:  A0A1U9N6P4 LinkDB All DBs Position 871990..872226 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINANLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtagcattgaagaacgcgtaaaaaagatcgttgctgagcaactgggtgtgaaagaa gaagaagttaaaaacgaagcttctttcgtcgaagatctgggcgctgattctttggatacc gtagagttggtaatggctctcgaagaagaattcgaaactgaaatccctgatgaagaagct gagaaaatcactaccgttcaattggctattgactacatcaatgccaacttggcgtaa

DBGET integrated database retrieval system