Cellvibrio sp. PSBB023: B0D95_04855 Help Entry B0D95_04855       CDS       T04725                                  Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism ceb  Cellvibrio sp. PSBB023 Pathway ceb02010   ABC transporters Brite KEGG Orthology (KO) [BR:ceb00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     B0D95_04855  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ceb02000]     B0D95_04855 Transporters [BR:ceb02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     B0D95_04855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD Toxin_BN_H Motif Other DBs NCBI-ProteinID:  AQT59489 UniProt:  A0A1U9N751 LinkDB All DBs Position 1070370..1070573 Genome browser AA seq 67 aa AA seqDB search MKFQFESLADFLAMSGHGPYVWASYAITFIALIFLVVNPVLQQRALVKQQKKLRKLAQGP LEPSSNP NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaaattccaatttgagtcactggcagattttttggcaatgagtggccatggtccttat gtgtgggcctcctatgccatcaccttcattgccctgatctttttggtagtaaacccagta ttacagcagcgggcattggtaaaacagcaaaaaaaattgcgcaaattggcgcaaggtcca ctagagccatcttccaacccttaa

DBGET integrated database retrieval system