Cellvibrio sp. PSBB023: B0D95_06865 Help Entry B0D95_06865       CDS       T04725                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism ceb  Cellvibrio sp. PSBB023 Brite KEGG Orthology (KO) [BR:ceb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ceb03036]     B0D95_06865 Chromosome and associated proteins [BR:ceb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     B0D95_06865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC Wtap Motif Other DBs NCBI-ProteinID:  AQT59833 UniProt:  A0A1U9N844 LinkDB All DBs Position complement(1543845..1544123) Genome browser AA seq 92 aa AA seqDB search MKWLLLVLVILLSYLQYRLWIGDGSLAHAHRLENEIKLQQAEIDRMRERNRILDVEVEEL KTGLDTIEERARNDIGLIKKDETFFIILDDEQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaagtggctgctgttagtgctggtaattttgctgagctatctgcaatacagattgtgg atcggcgacggcagtcttgcgcatgcgcatcggctggaaaatgagattaaactgcagcaa gctgaaattgatcgcatgcgcgagcgtaatcgcattcttgatgtggaagtggaagagcta aaaaccggcttggatactattgaagagcgtgcgcgcaacgatattggtctgatcaaaaaa gacgaaaccttttttattattctggatgacgaacaataa

DBGET integrated database retrieval system