Cellvibrio sp. PSBB023: B0D95_12530 Help Entry B0D95_12530       CDS       T04725                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ceb  Cellvibrio sp. PSBB023 Pathway ceb01100   Metabolic pathways ceb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ceb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     B0D95_12530    00074 Mycolic acid biosynthesis     B0D95_12530   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     B0D95_12530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L22e Motif Other DBs NCBI-ProteinID:  AQT60814 UniProt:  A0A1U9NBK1 LinkDB All DBs Position 2871710..2871904 Genome browser AA seq 64 aa AA seqDB search MGLDTVETVIWAEREFGVDIPDVDATEILSAGEFSSYLHEKLLLKQDFKAPSGDKVFARI KTFW NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgggcctcgatacggtagaaacggtaatctgggcagaacgagaatttggagtagatatt cctgatgttgatgctactgaaatattaagcgcaggggaattctcatcctaccttcacgag aagcttttgctgaaacaggatttcaaggctccatcaggagataaagtttttgcgagaatc aaaactttttggtaa

DBGET integrated database retrieval system