Cellvibrio sp. PSBB023: B0D95_12800 Help Entry B0D95_12800       CDS       T04725                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism ceb  Cellvibrio sp. PSBB023 Brite KEGG Orthology (KO) [BR:ceb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ceb03036]     B0D95_12800 Chromosome and associated proteins [BR:ceb03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     B0D95_12800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB TMF_TATA_bd Spc24 CENP-H Wtap DivIC Motif Other DBs NCBI-ProteinID:  AQT60863 UniProt:  A0A1U9NB57 LinkDB All DBs Position 2928175..2928381 Genome browser AA seq 68 aa AA seqDB search MSDDLLLALETKLDKLILQCNRLQQENAELKARENEWQRERVRLIEKNELARSRVEAMIT HLRNLDAE NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtctgacgatcttttactcgcccttgaaaccaagctggataagctgattctgcagtgc aatcgcctgcagcaagaaaacgccgagcttaaagcgcgcgaaaacgaatggcagcgcgag cgtgttcgcttgatcgagaagaatgaactggcccgcagccgtgtggaagccatgatcacc catttacgtaatctggacgccgaataa

DBGET integrated database retrieval system