Dickeya fangzhongdai ND14b: LH89_04410
Help
Entry
LH89_04410 CDS
T03347
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
KO
K02041
phosphonate transport system ATP-binding protein [EC:
7.3.2.2
]
Organism
ced
Dickeya fangzhongdai ND14b
Pathway
ced02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
ced00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
LH89_04410
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ced02000
]
LH89_04410
Enzymes [BR:
ced01000
]
7. Translocases
7.3 Catalysing the translocation of inorganic anions and their chelates
7.3.2 Linked to the hydrolysis of a nucleoside triphosphate
7.3.2.2 ABC-type phosphonate transporter
LH89_04410
Transporters [BR:
ced02000
]
ABC transporters, prokaryotic type
Phosphate and amino acid transporters
Phosphonate transporter
LH89_04410
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
AAA_21
RsgA_GTPase
SMC_N
AAA_29
nSTAND1
AAA_16
AAA_30
AAA_22
MMR_HSR1
SbcC_Walker_B
KdpD
FtsK_SpoIIIE
Cellulase
AAA_25
NB-ARC
DehI
AAA_23
SO_alpha_A3
Motif
Other DBs
NCBI-ProteinID:
AIR68488
LinkDB
All DBs
Position
complement(998527..999387)
Genome browser
AA seq
286 aa
AA seq
DB search
MAQALLASESATQLRAQHFQTQPQQTILSVRQLCKAYSGQQKRVLENLSFDLHAGEMVAV
IGRSGAGKSTLLHVMNGTIPASEGQILRYPAQHDGGQGDTQDILRFSSRQMRQWRSECGM
IFQDFCLVPRLDVLTNVLLGRLSRTSTLKSFFKLFSDEDRAHAIGLLQWMNLLPHALQRA
ENLSGGQMQRVAICRALMQNPKILLADEPVASLDPKNTRRIMDVLRQVSDNGITVVVNLH
SVELVKEYCTRAIGIAQGRILFDGPPSELTDSLLRTLYGDDLQPVH
NT seq
861 nt
NT seq
+upstream
nt +downstream
nt
atggcacaggcactgttggcatccgaaagcgctacccaactgcgcgcacagcatttccag
acgcaaccgcagcagaccattctgtcggtgcgtcagctgtgtaaggcctattccggccag
cagaaacgggtgctggagaatctcagttttgatttgcacgccggcgagatggtagcggtg
attggccgttccggcgccggtaagtccaccttgctgcacgtgatgaacggcactattccg
gccagcgaagggcaaatcctgcgctatcctgcccagcacgatggcgggcagggcgacacg
caggacattctgcgtttcagcagccggcagatgcgccagtggcgcagcgaatgcggcatg
atctttcaggatttttgtctggtgccgcggttggatgtgctgaccaacgtactgctgggc
cgcctgagccggacctccaccctgaagtcgttcttcaaactgttttccgatgaggatcgt
gcgcacgccattgggctgctgcaatggatgaacctgctgccgcatgcgttgcagcgggcg
gaaaacctgtccggcggccagatgcagcgcgtcgctatctgccgtgcgctgatgcagaac
cccaaaatcctgctggccgacgagccggtggcgtcgctcgacccgaaaaacacccgccgc
atcatggacgtgttgcgacaggtgagcgacaacggcatcaccgtggtggtgaacctgcat
tcggtcgagctggtgaaagaatactgcacccgggctattggcatcgcccaggggcgcatc
ctgtttgacggcccgccgtcagaactgaccgacagcctgctgcgtaccttgtacggcgac
gatctgcagccggtgcactaa
DBGET
integrated database retrieval system