Dickeya fangzhongdai ND14b: LH89_12535 Help Entry LH89_12535        CDS       T03347                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ced  Dickeya fangzhongdai ND14b Pathway ced00998   Biosynthesis of various antibiotics ced01100   Metabolic pathways ced01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ced00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH89_12535    00074 Mycolic acid biosynthesis     LH89_12535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH89_12535 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIR69992 LinkDB All DBs Position complement(2842526..2842792) Genome browser AA seq 88 aa AA seqDB search MEDLFLEIKQMIIDALNLEEVSVDEIETEAPLFGEGLGLDSIDALELGLAVKNRYGVVLS AESEEMRQHFFSVATLASFIMSQRQACA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaagatcttttccttgaaatcaaacaaatgattatcgatgccttgaaccttgaggaa gtgagcgtcgatgaaatcgagactgaggcccctttgtttggcgaaggcctggggctggat tcgatcgacgcgcttgagctcggtctggcggtgaaaaaccgctatggtgtggtgctttcc gccgaaagcgaggaaatgcggcagcatttcttttccgtcgcgacgctggcgtcattcatt atgtctcagcgtcaggcctgcgcctga

DBGET integrated database retrieval system