Dickeya fangzhongdai ND14b: LH89_21595 Help Entry LH89_21595        CDS       T03347                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ced  Dickeya fangzhongdai ND14b Pathway ced00998   Biosynthesis of various antibiotics ced01100   Metabolic pathways ced01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ced00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH89_21595    00074 Mycolic acid biosynthesis     LH89_21595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH89_21595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIR71682 LinkDB All DBs Position 4852204..4852473 Genome browser AA seq 89 aa AA seqDB search MDAQKEILAVVLDIINGIKNTGFTPDVVELDSFIGGELGVDSVEMLESWYEIEKRLHIKV NDSDKRGIYTLGDLIGTIEANLPAEAVKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggatgctcagaaagagattctcgcggtggtgctcgacattatcaatggcatcaaaaat accgggtttacgcctgatgtcgtggagttggattcgtttatcggcggcgagcttggcgtg gattcggtcgagatgctggagtcctggtacgagatcgagaagcggctccacatcaaggtc aacgacagcgacaagcgcggtatttacacgcttggcgacctgatcggcacgattgaggcc aatctaccggcagaggctgtcaagtcctga

DBGET integrated database retrieval system