Cellvibrio sp. KY-GH-1: D0C16_02150 Help Entry D0C16_02150       CDS       T06422                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ceg  Cellvibrio sp. KY-GH-1 Pathway ceg00998   Biosynthesis of various antibiotics ceg01100   Metabolic pathways ceg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ceg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0C16_02150    00074 Mycolic acid biosynthesis     D0C16_02150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0C16_02150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Gag_p24_C Motif Other DBs NCBI-ProteinID:  QEY14877 UniProt:  A0A5J6P266 LinkDB All DBs Position 520172..520408 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINANLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtagcattgaagaacgcgtaaaaaagatcgttgctgagcaactgggtgtgaaagaa gaagaagtgaaaaacgaagcttctttcgtcgaagatctgggcgctgattctttggatacc gtagagttggtaatggctctcgaagaagaattcgaaactgaaattccagatgaagaagct gagaaaatcactactgttcaattggctatcgattacatcaatgccaacctggcgtaa

DBGET integrated database retrieval system