Cellulomonas sp. JZ18: GC089_07265 Help Entry GC089_07265       CDS       T06322                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cej  Cellulomonas sp. JZ18 Pathway cej01100   Metabolic pathways cej01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cej00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GC089_07265    00074 Mycolic acid biosynthesis     GC089_07265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GC089_07265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Gmx_para_CXXCG Motif Other DBs NCBI-ProteinID:  QGQ19067 LinkDB All DBs Position complement(1591758..1592009) Genome browser AA seq 83 aa AA seqDB search MAYSEQEILAGLAEIVSEETGLPTDSVLPEKSFTDDLDIDSLSMMTIVTLAEEKFDVRIP DDEVKNLATVGDAVSFINGAQAA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgtacagcgagcaggagatcctggccggcctggccgagatcgtcagcgaggagacc ggcctgccgaccgactccgtcctgcccgagaagtccttcaccgacgacctggacatcgac tcgctgtcgatgatgacgatcgtcaccctcgccgaggagaagttcgacgtgcgcatcccc gacgacgaggtcaagaacctcgccacggtgggcgacgccgtcagcttcatcaacggcgcc caggcggcctga

DBGET integrated database retrieval system