Cellvibrio sp. KY-YJ-3: D0B88_05940 Help Entry D0B88_05940       CDS       T06234                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cek  Cellvibrio sp. KY-YJ-3 Pathway cek00998   Biosynthesis of various antibiotics cek01100   Metabolic pathways cek01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cek00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0B88_05940    00074 Mycolic acid biosynthesis     D0B88_05940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0B88_05940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QEY11853 LinkDB All DBs Position complement(1400544..1400813) Genome browser AA seq 89 aa AA seqDB search MSAQTAAQLEMAELLVEALNLEDIAASEIAPDESLFGDGLGLDSIDALEIALAISQKYGV QMQADDERTRKAFATLASLTEFVQNNSGN NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgcgcaaaccgctgcccaattggaaatggccgaactactggtagaagcactgaat ctggaagatatagcggcgagtgagatagcaccggatgaatccttatttggcgatggcctg gggctggattccatcgacgcactcgaaatcgccctcgccatttcgcaaaaatacggcgtg caaatgcaagccgacgacgagcgcacccgcaaggcctttgccaccctcgcctcgctgacc gagttcgtccagaacaatagcggcaactaa

DBGET integrated database retrieval system