Caenorhabditis elegans (nematode): CELE_F13G3.4 Help Entry CELE_F13G3.4      CDS       T00019                                  Symbol dylt-1 Name (RefSeq) DYnein Light chain (Tctex type)   KO K10420   dynein light chain Tctex-type 1/3 Organism cel  Caenorhabditis elegans (nematode) Pathway cel04814   Motor proteins Brite KEGG Orthology (KO) [BR:cel00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     CELE_F13G3.4 (dylt-1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cel03037]     CELE_F13G3.4 (dylt-1)    04812 Cytoskeleton proteins [BR:cel04812]     CELE_F13G3.4 (dylt-1) Cilium and associated proteins [BR:cel03037]  Motile cilia and associated proteins   Dynein arm    CELE_F13G3.4 (dylt-1) Cytoskeleton proteins [BR:cel04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      CELE_F13G3.4 (dylt-1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 DUF5618 CEP76_N Motif Other DBs NCBI-GeneID:  172476 NCBI-ProteinID:  NP_492063 WormBase:  WBGene00008764 Ensembl:  WBGene00008764 UniProt:  Q19416 LinkDB All DBs Position I:complement(7300061..7300913) Genome browser AA seq 106 aa AA seqDB search MALAEEDVHMIIKQVLDEVVGASTQYTHKDSVQWNQKAVEQITKKLVAAGKPYKYVVTSS FLQISSGSGLNVSTISYWNKVTDSSYMYRWEAKTMLAIVYVFAIAI NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggctttggcagaggaggacgttcacatgatcatcaagcaggtactcgacgaggttgta ggcgcaagcacccagtatacccacaaggacagtgttcagtggaatcagaaggccgtcgaa caaataacgaagaagctagtggcagcgggaaaaccatacaaatatgtggttacctcgtcg ttccttcagatctcgagcggttccggtctcaatgttagcacgatttcctactggaataaa gtcacggattcctcgtacatgtaccgttgggaagccaaaacaatgcttgcaatcgtctat gtttttgcaattgcaatttaa

DBGET integrated database retrieval system