Cellvibrio sp. PSBB006: CBR65_02110 Help Entry CBR65_02110       CDS       T04891                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cell  Cellvibrio sp. PSBB006 Pathway cell01100   Metabolic pathways cell01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cell00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CBR65_02110    00074 Mycolic acid biosynthesis     CBR65_02110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CBR65_02110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB HLH Gag_p24_C Motif Other DBs NCBI-ProteinID:  ARU26321 UniProt:  A0A1Y0FSE3 LinkDB All DBs Position 466563..466799 Genome browser AA seq 78 aa AA seqDB search MSSIEERVKKIVAEQLGVKEEEVKNEASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQLAIDYINANLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcagcattgaagaacgcgtaaaaaaaatcgttgctgagcaactgggtgtgaaagaa gaagaagttaaaaacgaagcttcttttgtagaagatctgggtgctgactctctcgacacc gtagagctggttatggctctggaagaagagttcgagacagaaatccccgatgaagaagct gagaaaatcaccacagttcagctggctatcgattacattaacgccaacctggcgtaa

DBGET integrated database retrieval system