Cellvibrio sp. PSBB006: CBR65_05110
Help
Entry
CBR65_05110 CDS
T04891
Symbol
fliI
Name
(GenBank) flagellum-specific ATP synthase FliI
KO
K02412
flagellum-specific ATP synthase [EC:
7.4.2.8
]
Organism
cell
Cellvibrio sp. PSBB006
Pathway
cell02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
cell00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
CBR65_05110 (fliI)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
cell02044
]
CBR65_05110 (fliI)
02035 Bacterial motility proteins [BR:
cell02035
]
CBR65_05110 (fliI)
Enzymes [BR:
cell01000
]
7. Translocases
7.4 Catalysing the translocation of amino acids and peptides
7.4.2 Linked to the hydrolysis of a nucleoside triphosphate
7.4.2.8 protein-secreting ATPase
CBR65_05110 (fliI)
Secretion system [BR:
cell02044
]
Type III secretion system
Flagellar export apparatus
CBR65_05110 (fliI)
Bacterial motility proteins [BR:
cell02035
]
Flagellar system
Flagellar assembly proteins
Type-III secretion
CBR65_05110 (fliI)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_ab
T3SS_ATPase_C
ATP-synt_ab_N
ABC_tran
AAA_22
DUF4168
Motif
Other DBs
NCBI-ProteinID:
ARU26858
LinkDB
All DBs
Position
complement(1234927..1236318)
Genome browser
AA seq
463 aa
AA seq
DB search
MADQRVSIVERIRGYAPGKPRVIEPEAEGRITRSVGLTLEAIGLNVSVGRQCEVIAGDNR
RIEAEVVGFAGDKVFLMPIKRVEGLQPGARVIPIATQQGMRIGPQLLGRVVNGIGQPLDG
KGPLVGDEYLDFTPHEINPLQRHPISEPLDVGVRAINALITVGRGQRLGLFAGSGVGKSV
LMGMMTKFTTADIVVVGLVGERGREVKEFIDHILGAEGLRRAVVVASPADDAPLMRLRAS
QLSSRIAEYYRDQGKNVLLLMDSLTRFAQAQREIALAIGEPPATKGYPPSVFAKIPQLVE
RAGNAAEGEGSITAFYTVLTEGDDLQDPIADAARAILDGHVVLSRKLAEEGTYPAIDVES
SISRAMQNIVSEEHLKMMQRFKQLSSRYQQNRDLIAIGAYTPGADPETDLAIERFPHLRA
FIQQGLKQPVHMAECIANLKALLKPTAPGKPTSPLAAQHRVQG
NT seq
1392 nt
NT seq
+upstream
nt +downstream
nt
atggctgatcaacgcgtatccattgttgaacgcatacgcggttacgcgccgggtaaaccc
agggttattgaaccggaagcagaaggccgtattacccggtccgtcggcctgacgctggaa
gccatcgggttgaatgtatcggtgggtcggcaatgcgaagtgattgcaggggataaccgg
cgtatcgaagccgaagtggtcggttttgctggcgacaaagtgttcctcatgccgatcaag
cgagttgaaggtttgcagccgggcgcacgcgtaattcctatcgcgacccagcagggtatg
cgcatcggcccacaactgctcggccgcgtcgtgaatggcatcggccaaccactggatggc
aaaggcccgctggtgggcgatgaatacctcgactttactcctcacgaaatcaaccccctg
cagcgccaccctatcagcgagccgctggatgtcggtgtgcgcgctatcaacgcgctgatt
accgtcgggcgtggccagcgtctgggtctgtttgccggcagcggcgtgggcaagagtgtg
ttaatgggcatgatgaccaagttcaccaccgccgacattgtcgtggtggggcttgtgggt
gagcgcggtcgcgaagtgaaagaatttattgatcatatcctcggcgcagaagggctgcgt
cgcgcggtggtggtggcatccccggcggatgatgcgcccttgatgcgtttgcgcgcttcg
cagttatccagccgtattgccgagtactaccgcgaccagggcaaaaatgtattgttgttg
atggattccctgacccggtttgcccaggcccagcgcgaaattgcactggcgattggcgaa
ccaccagccaccaaaggttatccgccatccgtgtttgcgaaaattccccaattggtggag
cgcgccggtaacgcggccgaaggtgagggctctatcaccgcgttttatacggtattgacc
gagggcgatgatctgcaagatcccattgctgatgcggcgcgagccattcttgacggccac
gtcgtcctgtcgcgcaagctggcggaggagggcacttatcccgctattgatgtggaatca
tccatcagtcgtgccatgcaaaatattgtgagcgaagaacatctgaagatgatgcagcgc
ttcaaacaattgtcgtcgcgctatcaacagaaccgcgacctgatcgccatcggtgcctac
acacccggtgctgatccggaaacggatctggctattgaacgtttcccgcatctgcgcgcc
tttatacaacaaggactcaaacaaccggtgcacatggcggaatgtatcgccaatctcaaa
gccttgttaaaacccaccgcccccggtaaaccgaccagtcccctggctgctcagcaccgc
gttcaaggctaa
DBGET
integrated database retrieval system