Cellvibrio sp. PSBB006: CBR65_11685
Help
Entry
CBR65_11685 CDS
T04891
Name
(GenBank) hypothetical protein
Organism
cell
Cellvibrio sp. PSBB006
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA_C
GFO_IDH_MocA
GFO_IDH_MocA_C3
NAD_binding_3
Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID:
ARU28034
LinkDB
All DBs
Position
complement(2795347..2796396)
Genome browser
AA seq
349 aa
AA seq
DB search
MSNRLRVALAAYGMSGRLFHAPFIQANPDFELTTILERSRTDSKEQFPTARIVRDYDDIL
QDASIDIVVVNTPNSMHYTMTEAALLAGKHVIVEKPFTPTVAEGEALVTLAQQQGLMLSV
YHNRRFASGYRTARQLLAESGVGELRSFTMTLERYRPQPGPKKWKEEHNPAAGLFYDMGI
HLLDESLLLFGLPQSLTADLRIQRQASQVNDYFDVRLDYPGFHVNLKGSLLAREPAPAYV
IHGEKGTYIKQQQDVQEPRLLAGVTPTAPGWAEESESEWGLLHNDEGRQKYPTVTGDYQD
FYRNVHAHLCVNEQLLTPPQQALLALRMLELALLSSQQQRTLPVHFSER
NT seq
1050 nt
NT seq
+upstream
nt +downstream
nt
atgtctaacagattgcgtgtagctttggctgcttatggtatgtccggccgtttattccac
gctcccttcattcaggcgaatcctgatttcgaattgacaacaattctggagcgctcacgc
acggattccaaagagcagttccccactgccagaatcgtgcgtgactatgacgatattttg
caagatgcctctattgatattgtcgtggtcaatacgccgaactccatgcactacaccatg
acagaagctgccttgttggcaggcaagcatgtcattgttgaaaaaccttttacgccaaca
gtagcggaaggtgaagcgctggtgacgctggcgcaacaacagggcttgatgctatcggtg
tatcacaatcgtcgttttgcttctggttatcgtacggcgcgtcagttattggcagagtcc
ggcgtgggtgaattaagaagttttaccatgacccttgagcgttatcggccgcaacccgga
ccgaaaaaatggaaagaagaacacaatccggcggcgggactgttttatgacatgggcatt
catctgctggatgaatccttgttgttatttggtttgccgcaatcattaactgccgacttg
cgcatccagcgacaagcgagtcaggtcaatgattactttgatgtacggctcgattatcct
ggctttcatgtaaacctcaaaggttcattgctggcacgtgagccggcgcctgcttatgtt
attcacggcgaaaaaggcacctatatcaaacagcagcaggatgttcaggaaccgcgactg
cttgccggtgtgacacccaccgcaccaggatgggcggaggagagcgagagtgaatggggt
ctgctgcacaacgatgaaggccgacaaaaatacccgaccgtgaccggcgattatcaggat
ttttatcgaaatgttcatgcccatttatgcgtcaacgagcagttgctgacgccgccgcaa
caggcgttattggcgctgcgcatgcttgaacttgcattattgagttcacaacagcagcgc
acattgccagtgcatttttctgaacgctga
DBGET
integrated database retrieval system