KEGG   Cedecea neteri M006: LH23_05565
Entry
LH23_05565        CDS       T03328                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
cem  Cedecea neteri M006
Pathway
cem00770  Pantothenate and CoA biosynthesis
cem01100  Metabolic pathways
cem01240  Biosynthesis of cofactors
Module
cem_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:cem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    LH23_05565 (coaD)
Enzymes [BR:cem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     LH23_05565 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AIR60146
UniProt: A0AAN0VST0
LinkDB
Position
complement(1170198..1170677)
AA seq 159 aa
MQKRAIYPGTFDPITNGHIDIVTRAASMFDQVILAIAASPSKNALFTLDERVALAQQALA
HLPNVQVLGFSDLMASFARKQQANVLVRGLRTAADFEYEMQLAHMNRHLMPELESVFLMP
SKEWSFVSSSLVKEVARHHGDVAHFLPEHVCKALIERLK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcaaaagcgggcaatctatccggggactttcgatcctatcaccaacggccatattgat
atcgttacccgtgcagccagtatgtttgaccaggtgatccttgccattgcagcaagcccc
agcaagaatgctttatttacgctggatgaacgcgttgcgctggcgcagcaggcgcttgca
catttacccaacgttcaggttctcggtttcagcgatttaatggcaagctttgcgcgcaag
cagcaggcaaacgtgctggtgcgtgggttgcgtaccgcggctgattttgaatatgaaatg
cagctggcccacatgaatcgccatctcatgccagaactggaaagcgtcttcctgatgcca
tctaaagagtggtcatttgtttcttcttctctggtcaaagaagtggcgcgccatcacggg
gatgtcgctcacttcctgccagagcacgtctgtaaagcgcttatcgaaaggcttaaatag

DBGET integrated database retrieval system