Cedecea neteri M006: LH23_11255 Help Entry LH23_11255        CDS       T03328                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cem  Cedecea neteri M006 Pathway cem01100   Metabolic pathways cem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH23_11255    00074 Mycolic acid biosynthesis     LH23_11255   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH23_11255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIR61218 UniProt:  A0A089UJQ7 LinkDB All DBs Position complement(2372914..2373171) Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIINTLNLDEMSSDDIDTDAALFGEGLGLDSIDALELGLAVKNQYGVVLS AESEEMRQHFFSVATLASFIHAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctctatcttgaaattaaaaatctcatcataaacacactcaatctggatgaa atgtcgagcgacgacattgacaccgatgcagcactttttggcgagggcttaggcctggac tctatagatgctctggaactggggctggcggtgaaaaaccagtacggtgtggtgctttct gcggaaagcgaagaaatgcgccagcacttcttttccgtcgccacgctggcatctttcatt cacgctcaacgagcctga

DBGET integrated database retrieval system