Cedecea neteri M006: LH23_13720 Help Entry LH23_13720        CDS       T03328                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cem  Cedecea neteri M006 Pathway cem01100   Metabolic pathways cem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH23_13720    00074 Mycolic acid biosynthesis     LH23_13720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH23_13720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH TerB Motif Other DBs NCBI-ProteinID:  AIR61672 UniProt:  A0A089UFT7 LinkDB All DBs Position 2882146..2882382 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIGEQLGVKQEEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINGHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattggcgaacaactgggcgttaagcaa gaagaagtagtgaacaccgcttccttcgttgaggacctgggcgctgattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaaaatcaccaccgttcaggctgccattgattacatcaacggccaccaggcgtaa

DBGET integrated database retrieval system