KEGG   Cedecea neteri ND14a: LH86_17425
Entry
LH86_17425        CDS       T03337                                 
Name
(GenBank) transporter
  KO
K03321  sulfate permease, SulP family
Organism
cen  Cedecea neteri ND14a
Brite
KEGG Orthology (KO) [BR:cen00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cen02000]
    LH86_17425
Transporters [BR:cen02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   LH86_17425
SSDB
Motif
Pfam: Sulfate_transp STAS STAS_2
Other DBs
NCBI-ProteinID: AIR66795
LinkDB
Position
3679777..3681432
AA seq 551 aa
MPFRALIDACWREKYTLSRFSRDAIAGVTVGIIAIPLAMALAIGSGVAPQYGLYTAAVAG
IVIALSGGSRFSVSGPTAAFVVILYPVAQQFGLAGLLVATLMSGIFLILFGLARFGRLIE
YIPLSVTLGFTSGIGITIATMQVKDFFGLTLEHVPEHYLNKVAALAMAMPTVNMGDAAIG
IVTLAVLILWPRLGLRLPGHLPALLAGCAVMAIVASLGGEVATIGSRFHYVLADGTQGNG
IPQLLPQLMLPWAMPNSEFTLSWDSLSALLPAAFSMAMLGAIESLLCAVVLDGMTGTKHN
ANSELVGQGLGNIIAPFFGGITATAAIARSAANVRAGATSPVAAIIHSLLVILALLALAP
LLSWLPLSAMAALLLMVAWNMSEAHKVVNLLRRAPKDDIIVMLICMSLTVLFDMVIAISV
GIVLASLLFMRRIARMTRLAPLNNVNVPEDVLALRVTGPLFFAAAEGLFIQLAQQVPGHR
VVVLQWDAVPLLDAGGLDAFQRFVEKMPEGCELRVTNLEFQPLRTLARAGVKPIPGRLTF
FPDVQAALAAS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atgcctttccgcgccctgattgatgcctgctggcgcgaaaagtacaccctgtctcgcttt
agccgcgacgccatcgccggcgtgaccgtcgggatcatcgctatccctctcgctatggcg
ctggccatcggcagcggcgttgcgccgcagtacggtttgtatactgccgccgtcgccggg
attgtcatcgcccttagcggcggctcgcgcttcagcgtctccggcccgacagcggctttc
gtggtgatcctctacccggtcgcacagcagtttggccttgcgggtctgctggttgccacg
ctgatgtccgggatattcctgatcctgtttgggctggcgcgctttgggcggcttatcgaa
tacattccgctgtcggtgacgctgggctttacctccgggatcggcatcaccattgcgacg
atgcaggtgaaagactttttcggcctgacgctggagcacgtgccggagcactacctgaat
aaagtggccgcgctggcgatggcgatgcccacggtgaatatgggcgacgctgcaatcggc
atcgtgacgctggcggtgctgattctctggccacgcctggggcttcgtctgccggggcat
cttcctgcgctgctggcgggctgcgccgtgatggcgattgttgcttctttgggtggtgaa
gtcgcgacgattggctcccggttccactacgtgctggccgacggcacccagggcaacggc
attccacagcttctgcctcagctaatgctcccatgggcgatgccaaattcggagtttacg
cttagctgggattcgctcagcgccctgctgcccgcggcgttctctatggccatgctgggt
gccatcgaatccctgctttgcgcggtggtgctggacggcatgaccggcactaaacacaac
gccaacagcgagctggtcggccaggggctgggaaatattattgccccgttcttcggcggt
attaccgccactgcggccattgcccgctccgccgctaacgtgcgtgccggggcaacttcg
ccggtagccgccattattcactcgctgctggtgatcctggccctgctggcgctcgcccct
ctgctttcctggctgccgctttcggcgatggcggccctgctgctgatggtggcgtggaat
atgagcgaggcgcataaagtcgtcaacctgctgcgccgggcaccgaaagacgacatcatc
gtgatgctaatctgcatgtcgttgaccgtgctgtttgacatggtgattgccatcagcgtt
ggcattgtgctggcgtcgctgcttttcatgcgccggatagcccgaatgacccgcctcgcg
ccgcttaacaatgtgaatgtgcctgaggatgtgctggcgcttcgcgtcacggggccgctg
ttctttgccgccgccgaagggctgttcattcagctcgcccagcaggtgccggggcatcgg
gtggttgttctgcaatgggatgcggtgccgctgctggacgcggggggtctggatgccttc
cagcgctttgtagagaaaatgccggaaggctgcgaactgcgggtgacgaaccttgaattc
cagccgctgcgcacgctcgcgcgggctggcgtgaagcccattcccggccgccttacgttc
ttcccggatgttcaggccgcactggccgccagttag

DBGET integrated database retrieval system