KEGG   Cedecea neteri ND14a: LH86_20145
Entry
LH86_20145        CDS       T03337                                 
Name
(GenBank) NADH:ubiquinone oxidoreductase subunit M
  KO
K00342  NADH-quinone oxidoreductase subunit M [EC:7.1.1.2]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00190  Oxidative phosphorylation
cen01100  Metabolic pathways
Module
cen_M00144  NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LH86_20145
Enzymes [BR:cen01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     LH86_20145
SSDB
Motif
Pfam: Proton_antipo_M PrgI Proton_antipo_N
Other DBs
NCBI-ProteinID: AIR67313
LinkDB
Position
complement(4263314..4264843)
AA seq 509 aa
MLLPWLILIPFIGGFFCWQTERFGVKVPRWIALITMGLTLALSLQLWLQGGYSLTQSAGL
PQWQSEFVLPWIPRFGIEIHLALDGLSLLMVVLTGLLGVLAVLCSWNEIEKYQGFFHLNL
MWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILGLVFVHYNATGVWTFNYELLLKTPMSHGVQWLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPEASAEFAPIAMWLGVIGIFY
GAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGNQLAYQGAVIQMIAHGLSAAGMFIICG
QLYERLHTRDMRMMGGLWNKIKWLPGLSMFFAVATLGMPGTGNFVGEFMILFGSFHVVPV
ITVISTFGLVFASVYSLAMLHRAYFGKAKSEISDKQLPGMSMREFFIILLLVVLLVLLGF
FPQPILDTSHSAMSNIQQWFTSSLSTTRP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgctattaccctggctaatactaatcccctttatcggcggcttcttctgctggcagacc
gaacgcttcggcgtgaaagtgcctcgctggattgcgctgatcaccatggggctgacactg
gcactgtctctgcaattgtggttgcagggtggctattctctgacgcagtcggcaggtttg
ccgcagtggcagtcagaattcgttctgccgtggatcccacgttttggcattgaaattcac
cttgcgctcgacggtctgtcgctgctgatggtggtgctgaccggcctgctcggcgtgctg
gcggtactctgttcctggaatgaaatcgaaaaatatcagggcttcttccacctcaacctg
atgtggatcctcggtggcgttatcggcgtgttccttgccatcgacatgttcctgttcttc
ttcttctgggaaatgatgctggtgccgatgtacttcctgattgcgctgtggggccacaaa
gcctccgacgggaagacgcgtattaccgctgcaaccaagttcttcatctatacccaggcg
agcggtctggtaatgttgattgctatcctgggtctggtgtttgtgcattacaacgcgacc
ggcgtatggaccttcaactatgagctgctgctgaaaacgccgatgtcccacggcgtacag
tggctgctgatgctgggcttctttatcgccttcgcggtaaaaatgccggtggttcctctt
cacggctggctgccggatgcgcactcccaggcaccaacggcgggttccgttgacctggcg
ggtattttgctgaaaaccgcggcctacggcctgctgcgtttctctctgccgctgttccct
gaagcgtccgctgagtttgcaccaatcgccatgtggctgggtgtcatcggtatcttctac
ggcgcgtggatggcctttgcccagaccgacatcaaacgcctgattgcttatacctccgtt
tcccacatgggcttcgtgctgattgccatctacaccggcaaccaactggcttaccagggc
gcggtgattcagatgattgctcacggtctgtctgcagccggtatgttcatcatctgcggt
cagctttacgagcgtctgcacacgcgtgacatgcgcatgatgggcggcctgtggaacaaa
attaaatggctgccgggcctgtcgatgttcttcgctgttgccacgctgggtatgccgggg
accggtaacttcgtcggtgaattcatgatcctgttcggcagcttccacgttgtgccggtc
attaccgtgatttcaaccttcggtctggtcttcgcttctgtttactctctggcgatgctg
caccgtgcttacttcgggaaagctaagagcgaaatcagcgataaacaactgcctggcatg
tccatgcgtgagttctttatcattctgttgctggtggtgctgttagttctgctgggcttc
ttcccgcagccgattctggatacctcgcattctgcgatgagcaatattcagcagtggttt
accagttcactttctactacaaggccgtaa

DBGET integrated database retrieval system