Comamonas endophytica: M9799_03340 Help Entry M9799_03340       CDS       T09983                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism cenp  Comamonas endophytica Pathway cenp02024   Quorum sensing cenp03018   RNA degradation Brite KEGG Orthology (KO) [BR:cenp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     M9799_03340 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     M9799_03340 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cenp03019]     M9799_03340 (hfq)    03036 Chromosome and associated proteins [BR:cenp03036]     M9799_03340 (hfq) Messenger RNA biogenesis [BR:cenp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      M9799_03340 (hfq) Chromosome and associated proteins [BR:cenp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     M9799_03340 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  UYG52287 UniProt:  A0ABY6GB31 LinkDB All DBs Position complement(781999..782256) Genome browser AA seq 85 aa AA seqDB search MSNKGQLLQDPFLNALRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STIVPGRAVNFSTAETAADNEAAGA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacaaaggccaactccttcaagacccgttcctcaacgcgctgcgccgcgagcat gtgccggtgtccatctatctggtcaacggcatcaagctgcagggccagatcgagtccttc gaccaatatgtcgtgctgctgcgcaacaccgtcacgcaaatggtgtacaagcacgcgatt tccaccatcgttcccggccgtgccgtgaacttctccacggctgaaaccgccgcagacaac gaagccgccggcgcctga

DBGET integrated database retrieval system