Citrobacter enshiensis: P2W74_14565 Help Entry P2W74_14565       CDS       T09732                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cens  Citrobacter enshiensis Pathway cens01100   Metabolic pathways cens01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cens00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P2W74_14565    00074 Mycolic acid biosynthesis     P2W74_14565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P2W74_14565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WET39212 LinkDB All DBs Position complement(2994611..2994871) Genome browser AA seq 86 aa AA seqDB search MLNREEVMEYTLYCLQGMVESGVDIHPDSELVNDLGLESIKVMDLLMLLEDKFDISIPIN ILLDVRTPAQLIEALIPYLESINGPL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgttaaatcgtgaagaagtaatggagtacaccctttactgtttacagggtatggtcgaa agcggagtggatattcatcctgacagcgagcttgttaatgatctcggtctggaatctatc aaagtaatggatttgttaatgctgctggaagataaattcgatatttccatccccattaat atattgctggatgtcagaacgcctgcgcaactcattgaagcactaatcccctatctggag agtatcaatgggccattatga

DBGET integrated database retrieval system