KEGG   Citrobacter enshiensis: P2W74_20260
Entry
P2W74_20260       CDS       T09732                                 
Symbol
lptF
Name
(GenBank) LPS export ABC transporter permease LptF
  KO
K07091  lipopolysaccharide export system permease protein
Organism
cens  Citrobacter enshiensis
Pathway
cens02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:cens00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    P2W74_20260 (lptF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cens02000]
    P2W74_20260 (lptF)
Transporters [BR:cens02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    P2W74_20260 (lptF)
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: WET40186
LinkDB
Position
complement(4260355..4261455)
AA seq 366 aa
MIIIRYLVRETLKSQLAILFILLLIFFCQKLVRILGAAVDGDIPANLVLSLLGLGVPEMA
QLILPLSLFLGLLMTLGKLYTESEITVMHACGLSKAVLVKAAMVLALFTGIVAAVNVMWA
GPLSSKHQDEVLAEAKANPGMAALAQGQFQQATNGSSVLFIESVDGSDFKDVFLAQIRPK
GNARPSVVVADSGHLTQLGDGSQVVTLNQGTRFEGTALLRDFRITDFQNYQAIIGHQAVA
LDPNDSEQMDMSALLSANTDRARAELHWRLTLVFTVFMMALMVVPLSVVNPRQGRVLSML
PAMLLYLLFFLVQTSLKSNGGKGKLDPALWMWVVNLAYLALAIGLNLWDTVPVRRLRARF
LRRGAV
NT seq 1101 nt   +upstreamnt  +downstreamnt
gtgataatcataagatatctggtacgggagacgctcaaaagccaacttgcgatccttttc
atcttgcttttgattttcttttgtcaaaagttagtgaggatcctcggtgcggcggttgac
ggtgatattccggcaaatctggtgctctcgctactggggctgggcgtgcctgaaatggcg
cagctcattctgcctctcagcctgttcctcgggctgctgatgacgctgggcaaactctat
actgaaagtgaaattacggtcatgcacgcctgcgggttgagcaaagccgtcctggtaaaa
gccgccatggtactggcgttgtttactggtattgtcgctgcggtcaacgtcatgtgggcg
ggacctttatcatctaaacatcaggatgaagtgctggcggaggcgaaagccaaccccggt
atggctgcgcttgcgcaggggcaattccagcaggcaaccaatggcagctcggtcctgttt
atcgaaagtgtcgatggcagcgacttcaaagatgtatttctcgcgcaaatccgcccgaaa
ggcaacgcccgtccttccgtggtagtggcggattccggacatttgacgcagcttggcgac
ggctctcaggtggtcaccctgaatcaggggacacgcttcgaagggaccgcactgttacgt
gatttccgcattaccgatttccagaactatcaggcgatcatcgggcatcaggcggttgcg
ctggatcccaatgattccgagcagatggatatgagcgctctgttgtcggccaataccgat
cgtgcccgggcggaactgcactggcgcctgacgctggtatttaccgtctttatgatggcg
ctgatggtcgtgccgctgagcgtggtgaacccgcgtcagggacgcgtcctgtcgatgctt
ccagcgatgttgctgtatctgttgttcttccttgtgcagacctccctgaaatccaatggc
ggtaaaggcaaactggacccggctctctggatgtgggtggtgaaccttgcgtatctggcg
ttggcgattggcctgaacttgtgggatacagtgccggtacgccgtctgcgtgcccgtttt
ctgcgtagaggagcggtgtaa

DBGET integrated database retrieval system