Cutibacterium equinum: O6R08_04410 Help Entry O6R08_04410       CDS       T09514                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cequ  Cutibacterium equinum Pathway cequ01100   Metabolic pathways cequ01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cequ00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     O6R08_04410    00074 Mycolic acid biosynthesis     O6R08_04410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     O6R08_04410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF5783 Ribosomal_L50 DUF7080 RepB_C Motif Other DBs NCBI-ProteinID:  WCC80723 LinkDB All DBs Position complement(963245..963490) Genome browser AA seq 81 aa AA seqDB search MADKDQILADMADIVNDITGVDQSEVTLEKSFVDDLDVDSLSMVEIIYACDEKFGVEIPD EESKNIKTVGDAVNYVIEHKD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggctgacaaagaccagatcctcgccgacatggctgacatcgtcaacgacatcaccggt gtcgaccagtccgaggtcacccttgagaagtccttcgtcgacgacctcgacgtcgactcc ctctccatggtcgaaatcatctacgcctgcgacgagaagttcggcgtcgagatccccgac gaggagtccaagaacatcaagaccgttggcgacgccgtcaactacgtcatcgagcacaag gactga

DBGET integrated database retrieval system