Chlamydia trachomatis E/SW3: ESW3_2381 Help Entry ESW3_2381         CDS       T02164                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ces  Chlamydia trachomatis E/SW3 Pathway ces01100   Metabolic pathways ces01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ces00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ESW3_2381 (acpP)    00074 Mycolic acid biosynthesis     ESW3_2381 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ESW3_2381 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CCE12511 LinkDB All DBs Position complement(264740..264973) Genome browser AA seq 77 aa AA seqDB search MSLEDDVKAIIVDQLGVSPEDVKVDSSFIEDLNADSLDLTELIMTLEEKFAFEISEDDAE QLRTVGDVIKYIQERQN NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtttagaagatgatgtaaaggcaattatagttgatcagctcggagtaagtcctgag gatgtcaaagtagactcttctttcatagaagatctaaatgcagacagcttggatttgaca gagttgattatgactttagaagagaaatttgcttttgaaatttctgaagatgatgccgag caactccgcacagtcggtgacgtgattaaatacatccaagagcgtcaaaactaa

DBGET integrated database retrieval system