Cellulosilyticum sp. WCF-2: EKH84_08285 Help Entry EKH84_08285       CDS       T06333                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cew  Cellulosilyticum sp. WCF-2 Brite KEGG Orthology (KO) [BR:cew00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cew03032]     EKH84_08285    03036 Chromosome and associated proteins [BR:cew03036]     EKH84_08285    03400 DNA repair and recombination proteins [BR:cew03400]     EKH84_08285 DNA replication proteins [BR:cew03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EKH84_08285 Chromosome and associated proteins [BR:cew03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EKH84_08285 DNA repair and recombination proteins [BR:cew03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EKH84_08285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-DNA_bdg HU-CCDC81_euk_1 UBA_HYPK Motif Other DBs NCBI-ProteinID:  QEH68380 UniProt:  A0A5B9YDS1 LinkDB All DBs Position 1888329..1888607 Genome browser AA seq 92 aa AA seqDB search MNKSELVAAMSAKAEISKKDAEKALKAFEDVVMEELQAGGKIQLVGFGTFEVTERKPRVG RNPKTNEEMPIPGGKAPKFKPGKALKDVVKGN NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatctgaattagtagctgctatgtctgcaaaagcagaaattagcaaaaaagat gctgaaaaagcacttaaggcttttgaagatgttgtaatggaagaacttcaagctggggga aaaattcaattagttggttttggaacatttgaagttacagagcgtaaaccacgtgtaggt agaaatccaaaaacaaatgaagaaatgccaatcccaggtggaaaagcacctaaattcaaa cctggtaaagctttaaaagatgttgttaaaggtaactaa

DBGET integrated database retrieval system