Caldisericum exile: CSE_00740 Help Entry CSE_00740         CDS       T01804                                  Name (GenBank) putative DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cex  Caldisericum exile Brite KEGG Orthology (KO) [BR:cex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cex03032]     CSE_00740    03036 Chromosome and associated proteins [BR:cex03036]     CSE_00740    03400 DNA repair and recombination proteins [BR:cex03400]     CSE_00740 DNA replication proteins [BR:cex03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CSE_00740 Chromosome and associated proteins [BR:cex03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CSE_00740 DNA repair and recombination proteins [BR:cex03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CSE_00740 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  BAL80200 UniProt:  A0A7U6GD93 LinkDB All DBs Position complement(67756..67992) Genome browser AA seq 78 aa AA seqDB search MAEALRKGDKVHLFNDLGTFEMRERKQRNAINPRTGERIIIPAKIVPHFKIGRRLKEAVK KGKPSIEEEIQDQEDFWL NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtggcagaagctcttagaaaaggcgataaagtgcacctttttaatgatcttggcactttt gaaatgagagaaagaaagcaaagaaatgctattaatccgagaacaggcgaaagaattata attccagcaaagatagttcctcactttaagattggcagaagactgaaagaggcagtgaaa aagggaaaaccttctattgaagaagaaattcaagatcaagaagatttttggctgtag

DBGET integrated database retrieval system