Caldisericum exile: CSE_01830 Help Entry CSE_01830         CDS       T01804                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cex  Caldisericum exile Pathway cex01100   Metabolic pathways cex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSE_01830 (acpP)    00074 Mycolic acid biosynthesis     CSE_01830 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSE_01830 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Ribosomal_L50 KTI12 Motif Other DBs NCBI-ProteinID:  BAL80309 UniProt:  A0A7U6GDD2 LinkDB All DBs Position 170006..170248 Genome browser AA seq 80 aa AA seqDB search MEEREIREKVARVVKEKLGVEDDKIVDSAEYVKDLGADSLALVDIAMALEDEFGVKIPDE DINKITTIGATISYIKEHLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaagaaagagaaattagagaaaaagttgctcgtgttgtaaaggagaaattaggtgtt gaggacgacaaaattgttgactctgcagaatatgtgaaggatcttggtgcagattctctt gcacttgttgacattgcaatggcacttgaagatgagtttggagtaaagattccagacgag gacatcaataaaattacaacaattggtgcaacgatttcctacattaaggagcacttaggg tag

DBGET integrated database retrieval system