Coxiella mudrowiae: CleRT_14760 Help Entry CleRT_14760       CDS       T03998                                  Name (GenBank) Uncharacterized protein   KO K09892   cell division protein ZapB Organism cey  Coxiella mudrowiae Brite KEGG Orthology (KO) [BR:cey00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cey03036]     CleRT_14760 Chromosome and associated proteins [BR:cey03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     CleRT_14760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APC_N_CC ZapB Sas6_CC Herpes_BLRF2 Sas-6_C_CC TSC22 NRBF2 YabA FapA Motif Other DBs NCBI-ProteinID:  AKQ33983 LinkDB All DBs Position 1612930..1613142 Genome browser AA seq 70 aa AA seqDB search MQPPHTIELSELEYQVDHLLRSLERLKTENNMLRQKLANNARERSLLVEKNLHAAQKIKK IIAQLREEIP NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgcaaccaccccacactattgaactcagtgaactcgaatatcaagtagatcacttattg cgttcattagagcgtctaaaaacagaaaataatatgctacggcaaaaattagcaaataat gcgcgggaacgatctttattggtagaaaaaaatcttcatgccgctcagaaaataaaaaaa ataatcgcacaattaagggaagaaataccatga

DBGET integrated database retrieval system