Canis lupus familiaris (dog): 100683352 Help Entry 100683352         CDS       T01007                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04015   Rap1 signaling pathway cfa04810   Regulation of actin cytoskeleton cfa05014   Amyotrophic lateral sclerosis cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100683352 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100683352 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100683352 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100683352 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     100683352 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cfa04812]     100683352 (PFN2)    04147 Exosome [BR:cfa04147]     100683352 (PFN2) Membrane trafficking [BR:cfa04131]  Others   Actin-binding proteins    Others     100683352 (PFN2) Cytoskeleton proteins [BR:cfa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100683352 (PFN2) Exosome [BR:cfa04147]  Exosomal proteins   Proteins found in most exosomes    100683352 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100683352 NCBI-ProteinID:  XP_022264450 Ensembl:  ENSCAFG00000008383 VGNC:  49940 LinkDB All DBs Position 23:complement(44551694..44557577) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcaaagaagtgctcggtgatcagagatagcctatacgtc gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaac gttgctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system