Canis lupus familiaris (dog): 100686212 Help Entry 100686212         CDS       T01007                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04061   Viral protein interaction with cytokine and cytokine receptor cfa04062   Chemokine signaling pathway cfa04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100686212 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     100686212 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100686212 (CCL22)    04062 Chemokine signaling pathway     100686212 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     100686212 (CCL22) Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Chemokines    100686212 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  100686212 NCBI-ProteinID:  XP_003433826 Ensembl:  ENSCAFG00000032287 VGNC:  38885 UniProt:  A0A8C0M8G7 A0A8I3MLU3 LinkDB All DBs Position 2:complement(55669094..55674886) Genome browser AA seq 93 aa AA seqDB search MASLKTPLLAALVFLVLTLQATEAGPYGANVEDSICCRDYIRHPLPLRLLKYFYWTSDSC RRPGVVFLTVKDREICADPRVPWVKKLLQKLDP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgaagactccgctcctggctgcccttgtcttccttgttctgacacttcaa gcgactgaggcaggtccttacggtgccaacgtggaagacagtatctgctgccgggactac atccgtcaccctctgcccctgcgtctgctgaagtatttctactggacttcagactcctgc cggaggcctggcgtggtcttcctaactgtcaaggatcgggagatctgtgctgaccccaga gtgccctgggtgaagaagcttctccagaagctggacccatga

DBGET integrated database retrieval system