Canis lupus familiaris (dog): 100688084 Help Entry 100688084         CDS       T01007                                  Name (RefSeq) interferon alpha-1/2 isoform X1   KO K05414   interferon alpha Organism cfa  Canis lupus familiaris (dog) Pathway cfa04060   Cytokine-cytokine receptor interaction cfa04151   PI3K-Akt signaling pathway cfa04217   Necroptosis cfa04620   Toll-like receptor signaling pathway cfa04621   NOD-like receptor signaling pathway cfa04622   RIG-I-like receptor signaling pathway cfa04623   Cytosolic DNA-sensing pathway cfa04630   JAK-STAT signaling pathway cfa04650   Natural killer cell mediated cytotoxicity cfa04936   Alcoholic liver disease cfa05152   Tuberculosis cfa05160   Hepatitis C cfa05161   Hepatitis B cfa05162   Measles cfa05163   Human cytomegalovirus infection cfa05164   Influenza A cfa05165   Human papillomavirus infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05168   Herpes simplex virus 1 infection cfa05169   Epstein-Barr virus infection cfa05170   Human immunodeficiency virus 1 infection cfa05171   Coronavirus disease - COVID-19 cfa05200   Pathways in cancer cfa05320   Autoimmune thyroid disease cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100688084    04151 PI3K-Akt signaling pathway     100688084   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100688084  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100688084  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100688084    04621 NOD-like receptor signaling pathway     100688084    04622 RIG-I-like receptor signaling pathway     100688084    04623 Cytosolic DNA-sensing pathway     100688084    04650 Natural killer cell mediated cytotoxicity     100688084  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100688084   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100688084    05161 Hepatitis B     100688084    05160 Hepatitis C     100688084    05171 Coronavirus disease - COVID-19     100688084    05164 Influenza A     100688084    05162 Measles     100688084    05168 Herpes simplex virus 1 infection     100688084    05163 Human cytomegalovirus infection     100688084    05167 Kaposi sarcoma-associated herpesvirus infection     100688084    05169 Epstein-Barr virus infection     100688084    05165 Human papillomavirus infection     100688084   09171 Infectious disease: bacterial    05152 Tuberculosis     100688084   09163 Immune disease    05320 Autoimmune thyroid disease     100688084   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100688084   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100688084  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cfa04052]     100688084 Cytokines and neuropeptides [BR:cfa04052]  Cytokines   Interferons    100688084 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100688084 NCBI-ProteinID:  XP_003431693 Ensembl:  ENSCAFG00000049301 UniProt:  P81255 LinkDB All DBs Position 11:complement(39438549..39439305) Genome browser AA seq 187 aa AA seqDB search MALPCSFSVALVLLSCHSLCCLACHLPDTHGLRNWRVLTLLGQMRRLSAGSCDHYTNDFA FPKELFDGQRLQEAQALSVVHVMTQKVFHLFCPDTSSAPWNMTLLEELCSGLSEQLDDLE ACPLQEAGLAETPLMHEDSTLRTYFQRISLYLQDRNHSPCAWEMVRAEIGRSFFSSTILQ ERIRRRK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgccctgctccttctcggtggccctggtgctgctcagctgccactccctgtgc tgtctggcttgccacctgcccgacacccacggcctgcgcaactggagggtcctgacgctc ctgggacagatgaggagactctccgccggctcttgtgaccactacaccaatgactttgcc ttccccaaggagctgtttgatggccagcggctccaggaggcgcaggccctctctgtggtc cacgtgatgacccagaaggtcttccacctcttctgcccggacacgtcctctgctccttgg aacatgactctcctggaggaactgtgctcggggctctctgagcagctggatgacctggag gcctgtcccctgcaggaggcggggctggccgagacccccctcatgcatgaggactccacc ctgaggacctacttccaaaggatctccctctacctgcaagacaggaaccacagcccgtgt gcctgggagatggtccgagcagaaatcgggagatccttcttctcctcgacaatcttgcaa gaaagaatcaggaggaggaaatga

DBGET integrated database retrieval system