Canis lupus familiaris (dog): 102153034 Help Entry 102153034         CDS       T01007                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism cfa  Canis lupus familiaris (dog) Pathway cfa04014   Ras signaling pathway cfa04015   Rap1 signaling pathway cfa04020   Calcium signaling pathway cfa04022   cGMP-PKG signaling pathway cfa04024   cAMP signaling pathway cfa04070   Phosphatidylinositol signaling system cfa04114   Oocyte meiosis cfa04218   Cellular senescence cfa04261   Adrenergic signaling in cardiomyocytes cfa04270   Vascular smooth muscle contraction cfa04371   Apelin signaling pathway cfa04625   C-type lectin receptor signaling pathway cfa04713   Circadian entrainment cfa04720   Long-term potentiation cfa04722   Neurotrophin signaling pathway cfa04728   Dopaminergic synapse cfa04740   Olfactory transduction cfa04744   Phototransduction cfa04750   Inflammatory mediator regulation of TRP channels cfa04910   Insulin signaling pathway cfa04912   GnRH signaling pathway cfa04915   Estrogen signaling pathway cfa04916   Melanogenesis cfa04921   Oxytocin signaling pathway cfa04922   Glucagon signaling pathway cfa04924   Renin secretion cfa04925   Aldosterone synthesis and secretion cfa04970   Salivary secretion cfa04971   Gastric acid secretion cfa05010   Alzheimer disease cfa05012   Parkinson disease cfa05022   Pathways of neurodegeneration - multiple diseases cfa05031   Amphetamine addiction cfa05034   Alcoholism cfa05133   Pertussis cfa05152   Tuberculosis cfa05163   Human cytomegalovirus infection cfa05167   Kaposi sarcoma-associated herpesvirus infection cfa05170   Human immunodeficiency virus 1 infection cfa05200   Pathways in cancer cfa05214   Glioma cfa05417   Lipid and atherosclerosis cfa05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102153034    04015 Rap1 signaling pathway     102153034    04371 Apelin signaling pathway     102153034    04020 Calcium signaling pathway     102153034    04070 Phosphatidylinositol signaling system     102153034    04024 cAMP signaling pathway     102153034    04022 cGMP-PKG signaling pathway     102153034  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102153034    04218 Cellular senescence     102153034  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102153034   09152 Endocrine system    04910 Insulin signaling pathway     102153034    04922 Glucagon signaling pathway     102153034    04912 GnRH signaling pathway     102153034    04915 Estrogen signaling pathway     102153034    04921 Oxytocin signaling pathway     102153034    04916 Melanogenesis     102153034    04924 Renin secretion     102153034    04925 Aldosterone synthesis and secretion     102153034   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102153034    04270 Vascular smooth muscle contraction     102153034   09154 Digestive system    04970 Salivary secretion     102153034    04971 Gastric acid secretion     102153034   09156 Nervous system    04728 Dopaminergic synapse     102153034    04720 Long-term potentiation     102153034    04722 Neurotrophin signaling pathway     102153034   09157 Sensory system    04744 Phototransduction     102153034    04740 Olfactory transduction     102153034    04750 Inflammatory mediator regulation of TRP channels     102153034   09159 Environmental adaptation    04713 Circadian entrainment     102153034  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102153034   09162 Cancer: specific types    05214 Glioma     102153034   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102153034    05163 Human cytomegalovirus infection     102153034    05167 Kaposi sarcoma-associated herpesvirus infection     102153034   09171 Infectious disease: bacterial    05133 Pertussis     102153034    05152 Tuberculosis     102153034   09164 Neurodegenerative disease    05010 Alzheimer disease     102153034    05012 Parkinson disease     102153034    05022 Pathways of neurodegeneration - multiple diseases     102153034   09165 Substance dependence    05031 Amphetamine addiction     102153034    05034 Alcoholism     102153034   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102153034    05418 Fluid shear stress and atherosclerosis     102153034  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfa01009]     102153034   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     102153034    03036 Chromosome and associated proteins [BR:cfa03036]     102153034   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     102153034 Protein phosphatases and associated proteins [BR:cfa01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102153034 Membrane trafficking [BR:cfa04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102153034 Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102153034 Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102153034 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EF_EFCAB10_C EH Dockerin_1 Temptin_C EF-hand_11 EFhand_Ca_insen DUF5580_M Caleosin SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  102153034 NCBI-ProteinID:  XP_005617262 LinkDB All DBs Position 2:complement(27440705..27441958) Genome browser AA seq 149 aa AA seqDB search MADQLSEEQVAEFKEAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLKGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDE EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgagcgaggaacaggtggccgagttcaaggaggccttctgcctgttt gacaaggacggggacggggccatcaccacccaggagctgggcaccgtcatgcgctccctg ggccagaaccccacggaggccgagctgcgggacatggtgggcgagatcgaccgggacggc aacggctccgtggacttccccgagttcctgggcatgatggccaggcagctgaagggcagg gacagcgaggagcagatccgcgaggccttccgcgtcttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctgggggagaagctaagtgacgag gaggtggacgagatgatccgggccgccgacgtggacggggacgggcaggtgaactacgaa gagttcgtccacatgctggtgtccaagtga

DBGET integrated database retrieval system