Canis lupus familiaris (dog): 102156643 Help Entry 102156643         CDS       T01007                                  Symbol H2BC7 Name (RefSeq) histone H2B type 1-K-like   KO K11252   histone H2B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102156643 (H2BC7)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102156643 (H2BC7)   09163 Immune disease    05322 Systemic lupus erythematosus     102156643 (H2BC7)   09165 Substance dependence    05034 Alcoholism     102156643 (H2BC7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     102156643 (H2BC7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     102156643 (H2BC7) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102156643 (H2BC7) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102156643 (H2BC7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  102156643 NCBI-ProteinID:  XP_005640168 VGNC:  83757 LinkDB All DBs Position 35:23981636..23983667 Genome browser AA seq 135 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRPLFPLGAGPPNKPDKMSSYM SPKTLKSQPAFQRKL NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcccgccaagtccgcgccggccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaggtgcaccccgacacgggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtccagggagatccagacggccgtgcgc ccgctgtttcccttgggagctggacctccaaataagcctgacaaaatgtcttcatatatg tcccctaagacacttaagagccagccagcttttcagcgtaagttgtaa

DBGET integrated database retrieval system