Canis lupus familiaris (dog): 106558236 Help Entry 106558236         CDS       T01007                                  Symbol H4C9 Name (RefSeq) histone H4   KO K11254   histone H4 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106558236 (H4C9)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106558236 (H4C9)   09163 Immune disease    05322 Systemic lupus erythematosus     106558236 (H4C9)   09165 Substance dependence    05034 Alcoholism     106558236 (H4C9)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     106558236 (H4C9) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106558236 (H4C9) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  106558236 NCBI-ProteinID:  XP_013965996 Ensembl:  ENSCAFG00000029986 VGNC:  83776 UniProt:  A0A8C0TQ44 F2Z4N2 LinkDB All DBs Position 35:24412082..24412954 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcaggtcgtggcaagggcgggaaggggctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc tttgggggttga

DBGET integrated database retrieval system