Canis lupus familiaris (dog): 106558405 Help Entry 106558405         CDS       T01007                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism cfa  Canis lupus familiaris (dog) Pathway cfa03082   ATP-dependent chromatin remodeling cfa04217   Necroptosis cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     106558405  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     106558405  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106558405  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     106558405   09165 Substance dependence    05034 Alcoholism     106558405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     106558405   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     106558405 Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106558405 Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106558405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  106558405 NCBI-ProteinID:  XP_013966888 LinkDB All DBs Position X:94443984..94444301 Genome browser AA seq 105 aa AA seqDB search MSGKRSSQNSCRLGKQTLSSSTKTKLKFSVSHEDHLLQENHPAQHLRFSSQVCLSAILKY VATNILELVGNEAHNDCRVQRAVNNNMQSSHLFEDDTTSQVSEMF NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgtctgggaaaagaagtagtcagaactcctgcaggcttgggaagcagacactctcctct tccacaaaaaccaagttgaaattctctgtgagccatgaagaccatctcctgcaggaaaac caccctgcccagcacctacgcttttccagccaggtttgcctctccgccattctgaaatat gtggccaccaacattctggagctggtgggcaatgaggcccacaatgactgcagggttcaa agggcagtgaacaacaacatgcagagcagccacctctttgaggatgacaccacttctcag gtctctgaaatgttctga

DBGET integrated database retrieval system