Canis lupus familiaris (dog): 106559817 Help Entry 106559817         CDS       T01007                                  Symbol H2BE1 Name (RefSeq) histone H2B type 2-E1   KO K11252   histone H2B Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     106559817 (H2BE1)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     106559817 (H2BE1)   09163 Immune disease    05322 Systemic lupus erythematosus     106559817 (H2BE1)   09165 Substance dependence    05034 Alcoholism     106559817 (H2BE1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     106559817 (H2BE1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     106559817 (H2BE1) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     106559817 (H2BE1) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    106559817 (H2BE1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TAF Motif Other DBs NCBI-GeneID:  106559817 NCBI-ProteinID:  XP_022259586 VGNC:  83760 LinkDB All DBs Position 16:complement(15856147..15860960) Genome browser AA seq 122 aa AA seqDB search MGAEHGQQPQSGGRRGRGSGDKKSKKRSRRKETYSMYIYKVLKQVHPDIGISSKAMSIMN SFVNDVFERLAGEAARLAQYSGRTTLTSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTS SK NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgggcgctgagcatgggcagcagccgcagtccgggggccgcaggggccgtggttctggc gataagaagtccaaaaagcgtagccggcgcaaggaaacctactcgatgtatatctacaag gtgctaaagcaggtgcacccggacatcggcatctcttccaaggccatgagcatcatgaac tcatttgtgaacgatgtgtttgaacggctggctggcgaggctgcccggcttgcccagtac tcgggccggaccacactgacatcccgggaggtccagacagcggtgcgtctgctgctgccc ggagagctggccaagcatgctgtatctgagggcaccaaggccgtcaccaagtacaccagc tccaagtga

DBGET integrated database retrieval system