Canis lupus familiaris (dog): 115945199 Help Entry 115945199         CDS       T01007                                  Symbol H4C12 Name (RefSeq) H4 clustered histone 12   KO K11254   histone H4 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04613   Neutrophil extracellular trap formation cfa05034   Alcoholism cfa05203   Viral carcinogenesis cfa05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     115945199 (H4C12)  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     115945199 (H4C12)   09163 Immune disease    05322 Systemic lupus erythematosus     115945199 (H4C12)   09165 Substance dependence    05034 Alcoholism     115945199 (H4C12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     115945199 (H4C12) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Nucleosome assembly factors    Histones     115945199 (H4C12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  115945199 NCBI-ProteinID:  NP_001361520 VGNC:  84559 LinkDB All DBs Position 35:complement(24870767..24871240) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggtcgcggcaagggcgggaaggggctgggcaagggcggcgccaagcgccaccgc aaggtgctgcgcgacaacatccagggcatcaccaagcccgccatccggcggctggcccgg cgcggcggcgtcaagcgcatctcgggcctcatctacgaggagacccgcggggtgctcaag gtgttcctggagaacgtgatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtctacgcgctcaagcgccagggccgcaccctctacggc ttcggcggctga

DBGET integrated database retrieval system