Canis lupus familiaris (dog): 119867319 Help Entry 119867319         CDS       T01007                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism cfa  Canis lupus familiaris (dog) Pathway cfa04382   Cornified envelope formation cfa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cfa00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     119867319  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     119867319  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     119867319 Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of microglial cells    119867319 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EFhand_Ca_insen EF-hand_1 PBP_dimer_2 Motif Other DBs NCBI-GeneID:  119867319 NCBI-ProteinID:  XP_038318195 UniProt:  A0A8C0T6T7 A0A8I3PDJ6 LinkDB All DBs Position 33:11768657..11768950 Genome browser AA seq 97 aa AA seqDB search MPSQMEHVMETMMFTFHKFAGVRGYLTKEDLRILIEKEFPGFLENQKDPLAMDKIMKDLG QCQDGKVDFQSFFSLIPRLTIACNDYFVIQMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccctctcaaatggagcatgtcatggaaaccatgatgttcacatttcacaaatttgct ggggttagaggctatttaacaaaggaggacctgagaatactcatagaaaaggagtttcct ggatttttagaaaatcaaaaagaccctctggccatggacaaaataatgaaggacctaggc cagtgccaagatggcaaagtggacttccagagcttcttttcactaattcctaggctcacc atcgcatgcaatgactattttgtaatacagatgaaacagaagggaaggaagtag

DBGET integrated database retrieval system