Canis lupus familiaris (dog): 403618 Help Entry 403618            CDS       T01007                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism cfa  Canis lupus familiaris (dog) Pathway cfa01521   EGFR tyrosine kinase inhibitor resistance cfa01524   Platinum drug resistance cfa04014   Ras signaling pathway cfa04064   NF-kappa B signaling pathway cfa04115   p53 signaling pathway cfa04137   Mitophagy - animal cfa04140   Autophagy - animal cfa04151   PI3K-Akt signaling pathway cfa04210   Apoptosis cfa04215   Apoptosis - multiple species cfa04621   NOD-like receptor signaling pathway cfa04630   JAK-STAT signaling pathway cfa05012   Parkinson disease cfa05014   Amyotrophic lateral sclerosis cfa05022   Pathways of neurodegeneration - multiple diseases cfa05145   Toxoplasmosis cfa05162   Measles cfa05166   Human T-cell leukemia virus 1 infection cfa05168   Herpes simplex virus 1 infection cfa05170   Human immunodeficiency virus 1 infection cfa05200   Pathways in cancer cfa05202   Transcriptional misregulation in cancer cfa05212   Pancreatic cancer cfa05220   Chronic myeloid leukemia cfa05222   Small cell lung cancer cfa05225   Hepatocellular carcinoma cfa05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     403618 (BCL2L1)    04630 JAK-STAT signaling pathway     403618 (BCL2L1)    04064 NF-kappa B signaling pathway     403618 (BCL2L1)    04151 PI3K-Akt signaling pathway     403618 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     403618 (BCL2L1)    04137 Mitophagy - animal     403618 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     403618 (BCL2L1)    04215 Apoptosis - multiple species     403618 (BCL2L1)    04115 p53 signaling pathway     403618 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     403618 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     403618 (BCL2L1)    05202 Transcriptional misregulation in cancer     403618 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     403618 (BCL2L1)    05225 Hepatocellular carcinoma     403618 (BCL2L1)    05220 Chronic myeloid leukemia     403618 (BCL2L1)    05222 Small cell lung cancer     403618 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     403618 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     403618 (BCL2L1)    05162 Measles     403618 (BCL2L1)    05168 Herpes simplex virus 1 infection     403618 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     403618 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     403618 (BCL2L1)    05014 Amyotrophic lateral sclerosis     403618 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     403618 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     403618 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     403618 (BCL2L1)    01524 Platinum drug resistance     403618 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cfa01009]     403618 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cfa03036]     403618 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cfa02000]     403618 (BCL2L1) Protein phosphatases and associated proteins [BR:cfa01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      403618 (BCL2L1) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     403618 (BCL2L1) Transporters [BR:cfa02000]  Other transporters   Pores ion channels [TC:1]    403618 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  403618 NCBI-ProteinID:  NP_001003072 Ensembl:  ENSCAFG00000007053 VGNC:  38408 UniProt:  A0A8C0TGM4 Q76LT7 LinkDB All DBs Position 24:complement(20792367..20843516) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system