Canis lupus familiaris (dog): 403648 Help Entry 403648            CDS       T01007                                  Symbol CLDN3 Name (RefSeq) claudin-3   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecule (CAM) interaction cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     403648 (CLDN3)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     403648 (CLDN3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     403648 (CLDN3)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     403648 (CLDN3)   09158 Development and regeneration    04382 Cornified envelope formation     403648 (CLDN3)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     403648 (CLDN3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     403648 (CLDN3)    04147 Exosome [BR:cfa04147]     403648 (CLDN3) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    403648 (CLDN3) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    403648 (CLDN3)   Exosomal proteins of colorectal cancer cells    403648 (CLDN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CdpA_N Amastin Motif Other DBs NCBI-GeneID:  403648 NCBI-ProteinID:  NP_001003088 VGNC:  39319 UniProt:  Q95KM5 LinkDB All DBs Position 6:8231695..8232703 Genome browser AA seq 218 aa AA seqDB search MSMGLEIAGTSLAVLGWLSTIVCCALPMWRVTAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKVYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPLVPDAQKREMGAGLYVGWAAAALQLLGGALL CCSCPPRDKKYAPTKIVYSAPRSAGPGTSTAYDRKDYV NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgtccatgggcctggagatcgcgggcacgtcgctggccgtgctgggctggctgagcacc atcgtgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcagcatcatc acggcgcagatcacctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag atgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgc gccctcatcgtcgtgtccatcctgctggccgccttcgggctcctcgtggcactcgtgggc gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggcg ggagtgctcttcctgctggccgccttgctcaccctggtgccggtgtcctggtcggccaac accatcatccgggacttctacaacccgctggtgccggacgcgcagaagcgggagatgggc gcgggcctgtacgtgggctgggcggccgcggctctgcagctgctggggggcgcgctgctc tgctgctcctgcccgccgcgcgacaagaagtacgcgcccaccaagatcgtctactccgcg ccgcgctccgccggccccggcaccagcacagcctacgaccgcaaggactacgtgtga

DBGET integrated database retrieval system