Canis lupus familiaris (dog): 403649 Help Entry 403649            CDS       T01007                                  Symbol CLDN2 Name (RefSeq) claudin-2   KO K06087   claudin Organism cfa  Canis lupus familiaris (dog) Pathway cfa03272   Virion - Hepatitis viruses cfa04382   Cornified envelope formation cfa04514   Cell adhesion molecules cfa04530   Tight junction cfa04670   Leukocyte transendothelial migration cfa05160   Hepatitis C Brite KEGG Orthology (KO) [BR:cfa00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     403649 (CLDN2)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     403649 (CLDN2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     403649 (CLDN2)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     403649 (CLDN2)   09158 Development and regeneration    04382 Cornified envelope formation     403649 (CLDN2)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     403649 (CLDN2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cfa03037]     403649 (CLDN2)    04147 Exosome [BR:cfa04147]     403649 (CLDN2)    04515 Cell adhesion molecules [BR:cfa04515]     403649 (CLDN2) Cilium and associated proteins [BR:cfa03037]  Other cilia and associated proteins   Stereociliary proteins    403649 (CLDN2) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    403649 (CLDN2)   Exosomal proteins of colorectal cancer cells    403649 (CLDN2) Cell adhesion molecules [BR:cfa04515]  Immunoglobulin superfamily   L1 family    403649 (CLDN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF4064 TMEM164 Clc-like Motif Other DBs NCBI-GeneID:  403649 NCBI-ProteinID:  NP_001003089 VGNC:  39316 UniProt:  Q95KM6 LinkDB All DBs Position X:66603000..66603952 Genome browser AA seq 230 aa AA seqDB search MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVV GGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGII LCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV NT seq 693 nt NT seq  +upstreamnt  +downstreamnt atggcctctctcggcctccaacttgtaggctacatcctaggcctcctggggctgttgggc accctggtggccatgctgcttcccagctggcgaacaagctcctacgttggtaccagcatc gtgacggcggtcggcttctccaagggcctctggatggagtgcgccacacacagcacaggc ataacccagtgtgacatctacagcaccctcctaggcctgcctgctgacatccaggctgcc caggccatgatggtgacatccagtgcgatctcttcgttggcctgcattgtctctgtggtg ggcatgagatgcactgtcttctgccaggactcccgagccaaagacagactggcggtggtg ggtggagtcttcttcatcattggaggcctcctgggcttcatccccgttgcctggaacctt cacgggatcctgcgggacttctactccccgctggtacccgatagcatgaagttcgagatc ggagaagctctctacctgggcattatttcctccttgttctccctggtagctggcatcatc ctctgcttttcctgcccactccagggaaatcgctccgactactatgactcctaccaggcc cagccccttgcaactagaggctctccaaggccgggtcaaccgcccaaagccaagagcgag tttaactcctacagcctgacagggtatgtgtga

DBGET integrated database retrieval system