Canis lupus familiaris (dog): 403773 Help Entry 403773            CDS       T01007                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism cfa  Canis lupus familiaris (dog) Pathway cfa04140   Autophagy - animal cfa04144   Endocytosis cfa04152   AMPK signaling pathway cfa04530   Tight junction cfa04972   Pancreatic secretion cfa05014   Amyotrophic lateral sclerosis cfa05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:cfa00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     403773 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     403773 (RAB8A)    04140 Autophagy - animal     403773 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     403773 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     403773 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     403773 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     403773 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cfa04131]     403773 (RAB8A)    03036 Chromosome and associated proteins [BR:cfa03036]     403773 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cfa04147]     403773 (RAB8A)    04031 GTP-binding proteins [BR:cfa04031]     403773 (RAB8A) Membrane trafficking [BR:cfa04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     403773 (RAB8A)  Autophagy   Other autophagy associated proteins     403773 (RAB8A) Chromosome and associated proteins [BR:cfa03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     403773 (RAB8A) Exosome [BR:cfa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    403773 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    403773 (RAB8A)   Exosomal proteins of colorectal cancer cells    403773 (RAB8A) GTP-binding proteins [BR:cfa04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     403773 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin DUF6974 AAA_7 Motif Other DBs NCBI-GeneID:  403773 NCBI-ProteinID:  NP_001003152 Ensembl:  ENSCAFG00000015782 VGNC:  45295 UniProt:  P61007 LinkDB All DBs Position 20:complement(46249113..46266419) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactcaactttcatctccact ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaagaacggtttcggacgatcacaacagcctattacaggggc gcaatgggcatcatgctggtctatgacatcaccaacgagaaatcctttgacaatatccgg aactggattcggaacattgaggagcatgcttctgcagatgtcgaaaagatgatactcgga aacaagtgtgatgtgaacgacaaaagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaac gcatttttcactctcgccagagacatcaaagcaaagatggacaaaaaattggaaggcaac agtccccaagggagcaaccagggagtcaaaatcacaccagaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system